PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400051946
Common NameLOC102593445
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 502aa    MW: 54140.7 Da    PI: 6.5865
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400051946genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.69.4e-32146203260
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                  WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                           +DgynWrKYGqK vkgsefprsYY+Ct+++C+vkk  ers  d++++ei+Y+g+H+h+k
  PGSC0003DMP400051946 146 EDGYNWRKYGQKLVKGSEFPRSYYKCTYPNCEVKKIFERSP-DGQITEIVYKGSHDHPK 203
                           7****************************************.***************85 PP

2WRKY106.51.4e-33317375159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ldDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  PGSC0003DMP400051946 317 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHD 375
                           59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.0E-27135204IPR003657WRKY domain
PROSITE profilePS5081122.653140204IPR003657WRKY domain
SuperFamilySSF1182901.27E-24142204IPR003657WRKY domain
SMARTSM007749.1E-34145203IPR003657WRKY domain
PfamPF031064.7E-24146202IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.0E-37302377IPR003657WRKY domain
SuperFamilySSF1182901.7E-29309377IPR003657WRKY domain
PROSITE profilePS5081138.825312377IPR003657WRKY domain
SMARTSM007743.1E-39317376IPR003657WRKY domain
PfamPF031062.9E-26318375IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 502 aa     Download sequence    Send to blast
MQGSSGSAAF SFMRSCSSGN AYGETTGEFE FKFAIASSST SGSLAKEAAV ISAGFNQQQS  60
EPLIQVQDRS LSQSLAPSTL VESEMPDSKE LSLPAPVSLE ASSISTSAAA TDNEEINQRG  120
QSNPSSQGSH ADNKDVSSVT AERSSEDGYN WRKYGQKLVK GSEFPRSYYK CTYPNCEVKK  180
IFERSPDGQI TEIVYKGSHD HPKPQPSRRF TPGALTSIQE DRGERDACLT GQEDKFNTNA  240
QTSNTEPSGT PLSPRQAGGD GLEGTVSQLH SANDQVDEDD PFAKRRKMDG GMDITPIVKP  300
IREPRVVVQT VSEVDILDDG YRWRKYGQKV VRGNPNPRSY YKCTNAGCPV RKHVERASHD  360
PKAVITTYEG KHNHDVPAAR TNNHEMAGSA PVTGGSRVRT EENGSVSLNL GVGIGYGMEN  420
RRNGQLHNLP AETVHSQAQV SSSSMMVVQP ATVAACYNIV NGGMSRFGTI ENRVQGTGFE  480
TLPLQSSAQC PQNYGRILLG P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-38146378878Probable WRKY transcription factor 4
2lex_A2e-38146378878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB7111230.0AB711123.1 Solanum tuberosum StWRKY10 mRNA for transcription factor, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006344883.10.0PREDICTED: probable WRKY transcription factor 20
TrEMBLM1CX700.0M1CX70_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000766700.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.11e-125WRKY family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]